PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK20257.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRAS
Protein Properties Length: 550aa    MW: 63883.2 Da    PI: 6.9422
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK20257.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.31.7e-1111775483374
       GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
                +lL++cAeav++ d++ a++ L r+++++sp gd++qRla+yf+++ +arl+++ +  y+al +se s    ++ l+a++++  ++P++++s+  aNq+I
  PK20257.1 177 TLLTHCAEAVADYDQRTATEQLRRIRQHSSPCGDATQRLAHYFANGFEARLTGKKTASYSALVSSEMS---FADILKAYQVYITACPFMRMSYSFANQTI 273
                69***************************************************99999*999999998...9**************************** PP

       GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkp.. 198
                 + +++ + vHiiDf+i +G+QWp L+q L++ p+gpp+lRiTg++ p++g   +e++eet++rL++f+e+++vp e+nv +a+++e++++e+L+++p  
  PK20257.1 274 KKLAKNVRSVHIIDFGILYGFQWPELIQRLSKTPGGPPKLRITGIEIPQPGfrPSEKVEETKRRLENFCERFNVPSEYNV-IAQKWETIRYEDLNIDPdr 372
                **************************************************9****************************9.7***************999 PP

       GRAS 199 gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvv 298
                +E ++Vn+ ++l++++de+v ++++rd+vLkl+++++P+++++   +  ++++ F++rf e+l +ys lfd++++++pr++e r k E+++ gr+i+nv 
  PK20257.1 373 DELVVVNCLYRLKHIPDETVVMNNPRDTVLKLIRRINPDLFIHGVVNGAYSAPFFMTRFKETLFHYSPLFDMFDTTVPRQEEYRLKFEKAVYGRDIENVM 472
                **************************************************************************************************** PP

       GRAS 299 acegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                aceg er+er e++++W+ r +++GFk++pl++++ + +k  +   +++ + ve++ ++l++gWk+r+++ +S+W+
  PK20257.1 473 ACEGLERVERPESYRQWQVRNTRVGFKQIPLDQEIFEAVKNTVDSSYDNNFVVEQHGEWLLQGWKGRRIYCLSFWK 548
                ***********************************************999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098561.886149528IPR005202Transcription factor GRAS
PfamPF035145.8E-109177548IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 550 aa     Download sequence    Send to blast
MEEEDLERKF LILEEPLALQ AAEKPFYDLL GQNYPLSSNK GENSSSDHVQ SVDHFRRRTG  60
EASSFCHMGK TQILDLESLE CNLLDEQKGK RSLEREYGES QEESRKSKQS AIYSDDSEAT  120
EIMFDRVLLY EGDTTQSTVS TVRQKSSQNH QAKGSGRKVR FPKKEGNAKK EMVDLWTLLT  180
HCAEAVADYD QRTATEQLRR IRQHSSPCGD ATQRLAHYFA NGFEARLTGK KTASYSALVS  240
SEMSFADILK AYQVYITACP FMRMSYSFAN QTIKKLAKNV RSVHIIDFGI LYGFQWPELI  300
QRLSKTPGGP PKLRITGIEI PQPGFRPSEK VEETKRRLEN FCERFNVPSE YNVIAQKWET  360
IRYEDLNIDP DRDELVVVNC LYRLKHIPDE TVVMNNPRDT VLKLIRRINP DLFIHGVVNG  420
AYSAPFFMTR FKETLFHYSP LFDMFDTTVP RQEEYRLKFE KAVYGRDIEN VMACEGLERV  480
ERPESYRQWQ VRNTRVGFKQ IPLDQEIFEA VKNTVDSSYD NNFVVEQHGE WLLQGWKGRR  540
IYCLSFWKPT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-441795488375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010106508.10.0hypothetical protein L484_025268
SwissprotQ9XE581e-174SCL14_ARATH; Scarecrow-like protein 14
TrEMBLW9RU650.0W9RU65_9R
STRINGPOPTR_0001s24890.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-171SCARECROW-like 14